SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001956 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000001956
Domain Number - Region: 35-122,190-282
Classification Level Classification E-value
Superfamily TPR-like 0.00683
Family HAT/Suf repeat 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001956   Gene: ENSPANG00000010488   Transcript: ENSPANT00000022850
Sequence length 327
Comment pep:known_by_projection chromosome:PapAnu2.0:3:33393563:33415577:1 gene:ENSPANG00000010488 transcript:ENSPANT00000022850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGAPARMAEQENSRNGGRNRGGVQRVEGKLRASVEKGDYYEAHQMYRTLFFRYMSQSKHA
EARELMYSGALLFFSHGQQVRALFLIFVFLESLEKAEVEVADELLENLAKVFSLMDPNSP
ERVAFVSRALKWSSGGSGKLGHPRLHQLLALTLWKEQNYCESRYHFLHSADGEGCANMLV
EYSTSRGFRSEVDMFVAQAVLQFLCLKNKSSASVVFTTYTQKHPSIEDGPPFVEPLLNFI
WFLLLAVDGGKLTVFTVLCEQYQPSLRRDPMYNEYLDRIGQLFFGVPPKQTSSYGGLLGN
LLSSLMGSSEQEEGEESPSDGSPIELD
Download sequence
Identical sequences ENSPANP00000001956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]