SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001966 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000001966
Domain Number - Region: 24-43
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00133
Family CCCH zinc finger 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001966   Gene: ENSPANG00000005787   Transcript: ENSPANT00000016954
Sequence length 237
Comment pep:known chromosome:PapAnu2.0:19:47470590:47471303:-1 gene:ENSPANG00000005787 transcript:ENSPANT00000016954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAARGQPELPQEAPATEPAPPPACRFFLEGRCRFGARCRQPHPGAPAPPDCEAQPEAGA
KKPPLRTAADVIQRIRWDPRLDPADFSVGYVDRFLGVREEPFSAFCWDEPLAALGPGVLA
VPQHRVRFFRFRGRLVWDRASRTDLVFGSGSTAGRGPTILDALDNEGAHGAADAEWTPAV
AGQEAQAAPERGSTGPLRTGHQEPGVEEAGELEAAQEHALGAAADFEHWPQEDASQE
Download sequence
Identical sequences ENSPANP00000001966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]