SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001970 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001970
Domain Number 1 Region: 229-389
Classification Level Classification E-value
Superfamily eEF1-gamma domain 1.96e-72
Family eEF1-gamma domain 0.0000000165
Further Details:      
 
Domain Number 2 Region: 34-187
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.37e-38
Family Glutathione S-transferase (GST), C-terminal domain 0.0022
Further Details:      
 
Domain Number 3 Region: 1-33
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000141
Family Glutathione S-transferase (GST), N-terminal domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001970   Gene: ENSPANG00000003106   Transcript: ENSPANT00000003440
Sequence length 389
Comment pep:known_by_projection chromosome:PapAnu2.0:14:11161932:11177929:1 gene:ENSPANG00000003106 transcript:ENSPANT00000003440 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVP
PASTWVFPTLGIMHHNKQATENAKEEVRRILGLLDAHLKTRTFLVGERVTLADITVVCTL
LWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKK
DTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTF
VLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQR
LDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEE
TQTLVREYFSWEGSFQHVGKAFNQGKIFK
Download sequence
Identical sequences ENSPANP00000001970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]