SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001998 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001998
Domain Number 1 Region: 42-147
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000382
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001998   Gene: ENSPANG00000017306   Transcript: ENSPANT00000014699
Sequence length 168
Comment pep:known_by_projection chromosome:PapAnu2.0:14:2589229:2591247:-1 gene:ENSPANG00000017306 transcript:ENSPANT00000014699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCCSSPFHVFPNPAKVTVPPGKGPRRGRNGQRSGSHARHDMKSPDEVLREGELEKRSDS
LFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTGKYVYFTIVTTDHKE
IDFRCAGESCWNAAIALALIDLQNRPRPAGLSQPPGTHRTRRARRTRR
Download sequence
Identical sequences ENSPANP00000001998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]