SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002050 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002050
Domain Number 1 Region: 35-159
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.17e-18
Family Thioltransferase 0.000000539
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002050   Gene: ENSPANG00000024234   Transcript: ENSPANT00000010187
Sequence length 172
Comment pep:known_by_projection chromosome:PapAnu2.0:1:54203475:54238083:-1 gene:ENSPANG00000024234 transcript:ENSPANT00000010187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METRPRLGATCLLGFSFLLLVISSDGHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVI
IHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDP
SGKVHPEIINENGNPSYKYFYISAEQVVQGMKEAQERLTGDAFRKKHLEDEL
Download sequence
Identical sequences A0A096MQL7 A0A0D9S7A6 A0A2K5NBW2 A0A2K5Y5Q3 A0A2K6LFX1 A0A2K6NNF9 H9Z9J7
XP_007976950.1.81039 XP_010368723.1.97406 XP_011938069.1.92194 XP_017730899.1.44346 ENSPANP00000002050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]