SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002092 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002092
Domain Number 1 Region: 113-189,289-355,390-535
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 2.59e-84
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000663
Further Details:      
 
Domain Number 2 Region: 570-717
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00000000741
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0059
Further Details:      
 
Domain Number 3 Region: 26-78
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0000000256
Family Glutathione S-transferase (GST), C-terminal domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002092   Gene: ENSPANG00000015564   Transcript: ENSPANT00000014701
Sequence length 831
Comment pep:known_by_projection chromosome:PapAnu2.0:14:2658233:2718968:-1 gene:ENSPANG00000015564 transcript:ENSPANT00000014701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSSGQQAPDYRSILSISDEAARAQALNEHLSTRSYVQGYSLSQADVDAFRQLSTPPAD
PQLFHVARWFRHIEALLGSPCGKGQPCRLQASKGRRVQPQWSPPAGTQPCRLHLYNSLTR
NKEVFMPQDGKKVTWYCCGPTVYDASHMGHARSYISFDILRRVLKDYFKFDVFYCMNITD
IDDKIIKRARQNHLFEQYLEKRPEAAQLLEDVQAALKPFSVKLNETTDPDKKQMLERIQH
EVQLATEPLEKAVQSKLTGEEVNSCVEVLLEEAKDLLSDWLDSTLGSDVTDNSIFSKLPK
FWEGEFHRDMEALNVLPPDVLTRVSEYVPEIVNFVQKIVDNGYGYVSNGSVYFDTAKFAS
SEKHSYGKLVPEAVGDQKALQEGEGDLSISADRLSEKRSPNDFALWKASKPGEPSWPCPW
GKGRPGWHIECSAMAGTLLGASMDIHGGGFDLRFPHHDNELAQSEAYFENDCWVRYFLHT
GHLTIAGCKMSKSLKNFITIKDALKKHSARQLRLAFLMHSWKDTLDYSSNTMESALQYEK
FLNEFFLNVKDILRAPVDITGQFEKWGEEEAELNKNFYDKKTAIHEALCDNVDTRTVMEE
MRALVSQCNLYMAARKAVRKRPNRALLENIALYLTHMLKIFGAIEEESSLGFPVGGSGTS
LNLESTVMPYLQVLSEFREGVRKIAREQKVPEVLQLSDALRDDILPELGVRFEDHEGLPT
VVKLVDRNTLLKEREEKRQVEEEKRKKKEEAARRKQEQEAAKLAKMKIPPSEMFLSETDK
YSKFDENGLPTHDAEGKELSKGQAKKVKKLFEAQEKLYKEYLQMPQNGSFQ
Download sequence
Identical sequences ENSPANP00000002092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]