SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002127 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002127
Domain Number 1 Region: 39-259
Classification Level Classification E-value
Superfamily t-snare proteins 1.99e-50
Family t-snare proteins 0.000019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002127   Gene: ENSPANG00000003353   Transcript: ENSPANT00000027465
Sequence length 287
Comment pep:known_by_projection chromosome:PapAnu2.0:4:118660788:118661651:-1 gene:ENSPANG00000003353 transcript:ENSPANT00000027465 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDRLAELLDLSKQYDQQFPDGDDEFDSPHEDIVFETDHILESLYRDIQDIQDENQLLVA
DVKRLGKQNARFLTSMRRLSSIKRDTNSIAKAIKARGEVIHCKLRAMKELSEAAEAQHGP
HSAVARISRAQYNALTLTFQRAMHDYNQAEMKQRDNCKIRIQRQLEIMGKDVSGDQIEDM
FEQGKWDMFSENLLADVKGARAALNEIESRHRELLRLESRIRDVHELFLQMAVLVEKQAD
TLNVIELNVQKTVDYTGQAKAQVRKAVQYKKKNPCRTLCCFCCPCLK
Download sequence
Identical sequences A0A096MQU3 A0A2K5P8A1
ENSPANP00000002127 XP_011946792.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]