SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002177 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002177
Domain Number 1 Region: 1-81
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-19
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 2 Region: 86-277
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000266
Family Pentraxin (pentaxin) 0.0047
Further Details:      
 
Domain Number 3 Region: 764-1044
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000000201
Family Rhodopsin-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002177   Gene: ENSPANG00000011062   Transcript: ENSPANT00000025171
Sequence length 1125
Comment pep:known_by_projection chromosome:PapAnu2.0:4:119918003:119992606:-1 gene:ENSPANG00000011062 transcript:ENSPANT00000025171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTLRAPTGYIIQITFNDFDIEEAPNCIYDSLSLDNGESQTKFCGATAKGLSFNSSANEM
HVSFSSDFSIQKKGFNASYIRVAVSLRNQKVILPQTSDAYQVSVAKSVSIPELSAFTLCF
EATKVGHEDNDWTAFSYSNASFTQLLSFGKAKSGYFLSISDSKCLLNNALPVKEKEDIFA
ESFEQLCLVWNNSLGSIGVNFKRNYETVPCDSTISKVIPGNGKLLLGSNQNEIVSLKGDI
YNFRLWNFTMNAKILSNLSCNMKGNVVDWQNDFWNIPNLALKAESNLSCGSYLIPLPAAE
LASCADLGTLCQDGIIYRISVVIQNILRHPEVKVQSKVAEWLNSTFENWNYTVYVINISF
HLSGGEDKIKVKRSIENEPRLVLWALLVYNATNNTNLEGKIIQQKLLKNNESLDEGLRLH
TVNVRQVGYCLAVEEPKGYYWPSIQPSEYVLPCPDKPDFSASRICYYNATNRSLTYWGPP
DISSCSKANEVANQILDLTADGQNLTSANITNIVEQVKRIVNKEENIDITLGSTLMNIFS
NILSSSDSDLLESSSEALKTIDELAFKIDLNSTSHVNITTRNLALGVSSLLPGTNAISNF
SIGLPSNNESYFQMDFESGQVDPLASVILPPNLLENLSQEDSVLVRRAQFTFFNKTGLFQ
DVGPQRKTLVSYVMACSIGNITIQNLKDPVQIKIKHTRTQEVHHPICAFWDLNKNKSFGG
WNTSGCVAHRDSDASETVCLCNHFTHFGVLMDLPRSASQLDARNTKVLTFISYIGCGISA
IFSAATLLTYVAFEKLRRDYPSKILMNLSAALLFLNLLFLLDGWITSFNVDGLCIAVAVL
LHFFLLATFTWMGLEAIHMYIALVKVFNTYIRRYILKFCIIGWGLPALVVSIVLASRNKN
EVYGKESYGKEKGDEFCWIQDPVIFYVTCAGYFGVMFFLNIAMFIVVMVQICGRNGKRSN
RTLREEVLRNLRSVVSLTFLLGMTWGFAFFAWGPLNIPFTYLFSIFNSLQGLFIFIFHCA
MKENVQKQWRRHLCCGRFRLADNSDWSKTATNIIKKSSDNLGKSLSSSSIGSNSTYLTSK
SKSSSTTYFKRNSHTDNVSYEHSFNKNGSFRQCFHGQVLVKTGPC
Download sequence
Identical sequences ENSPANP00000002177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]