SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002178 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002178
Domain Number 1 Region: 599-663,701-799
Classification Level Classification E-value
Superfamily PH domain-like 4.46e-31
Family Pleckstrin-homology domain (PH domain) 0.0092
Further Details:      
 
Domain Number 2 Region: 1221-1352
Classification Level Classification E-value
Superfamily Second domain of FERM 6.41e-19
Family Second domain of FERM 0.0044
Further Details:      
 
Domain Number 3 Region: 806-924
Classification Level Classification E-value
Superfamily PH domain-like 8.66e-17
Family Pleckstrin-homology domain (PH domain) 0.031
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000002178
Domain Number - Region: 1120-1199
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000475
Family First domain of FERM 0.074
Further Details:      
 
Domain Number - Region: 29-120,706-726
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000879
Family BAR domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002178   Gene: ENSPANG00000019544   Transcript: ENSPANT00000011152
Sequence length 1496
Comment pep:known_by_projection chromosome:PapAnu2.0:13:42615226:42736623:1 gene:ENSPANG00000019544 transcript:ENSPANT00000011152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELSESEGPVDWKERCVALESQLMKFRVQASKIRELLAEKMQQLERQVIDAERQAEKAF
QQVQVMEDKLKAANIQTSESETRLYNKCQDLESLIQEKDDIIQNLELQLEEQKQIRIQEA
KIIEEKAAKIKEWVTVKLNELELENQNLRLINQNQTEEIRTMQSKLQEVQGKKSSTVSTL
KLSEGQRLSSLTFGCFLSRARSPPQVVKSEEMSKISSKEPEFTEGKDMEEMEIPEKSVDN
QVLENNRGQRTLHQTPCGSEQNRKTRTSFATEGGVSQNSGAPVSDWSSDEEDGNKGRSKS
RCTSTLSSHTSEEGVQCSRMGSEMYLTASDDSSSIFEEETFGIKRPEHKKLYSWQQEAQW
KALNSPLGKGNSESSKKEQDSSSDELNKKFQSQRLDYSSSSSEANTPSPILTPALMPKHP
NSLSGKGTQLVPSSHLPPPKLRIPNVFSISVALAKRHLSQPQLSSDRMCGTNRNAISMIR
PLRPQETDLDLVDGDSAEVLENMDTSCDDGLFSYDSLDSPNSDDQENFDSAKKAACSKPP
TPPLHRFPSWESRIYAVAKSGIRMSEAFNMENVNISDSVAALSYTTSGLYTSLIYKNMTT
PVYTTLKGKATQISSSPFLDDSSGSEEEDSSRSSSRTSESDSRSRSGPGSPRAMKRGVSL
SSVASESDYAIPPDAYSTDTEYSQPEQKLPKTCSSSSDNGKNEPLEKSGYLLKMSGKVKS
WKRRWFVLKGGELLYYKSPSDVIRKPQGHIELSASCSILRGDNKQTVQLTTEKHTYYLTA
DSPNILEEWIKVLQNVLRVQAANPLSLQPEGKPTVKGLLTKVKHGYSKRVWCTLIGKTLY
YFRSQEDKVLTDQIRLTESKKTGYLPKACDSDEDYEASGRSLLSTHYTIVIHPKDQGPTY
LLIGSKHEKDTWLYHLTVAAGSNNVNVGSEFEQLVCKLLNIDGEPSSQIWRHPTLCHSKE
GIISPLTTLPSEALQTEAIKLFKTCQLFINAAVDSPAIDYHISLAQSALQICLTHPELQN
EICCQLIKQTRRRQPQNQPGPLQGWQLLALCVGLFLPHHPFLWLLRLHLKRNADSRTEFG
KYAIYCQRCVERTQQNGDREARPSRMEILSTLLRNPYHHSLPFSIPVHFMNGIYQVVGFD
ASTTVEEFLNTLNQDTGMRKPAQSGFALFTDDPSGRDLEHCLQGNIKICDIISKWEQASK
EQQPGKCEGTRTVRLTYKNSRLYFSVQARGETDREKLLLMYQTNDQIINGLFPLNKDLAL
EMAALLAQVEIGDFERPFSTPAGHVTHQCKANQTLKQVIEKFYPKRYRDGCSEEQLRQLC
QRLSTRWMALRGHSAADCVRIYLTVARKWPFFGAKLFLAKPITPSSLGSTFMWLAVNEDG
LNLLEYNSMRLIVSYVYKSLMTFGGYQDDFMVVINNTHSKDTPTEKLLFAMAKPKILEIT
LLIASYINNFHQQKAAFHHLSAPALLSAQTRGPQARMMGSQPLLSSSRPTKGPTLL
Download sequence
Identical sequences ENSPANP00000002178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]