SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002179 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002179
Domain Number 1 Region: 187-223
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000000196
Family CCCH zinc finger 0.00017
Further Details:      
 
Domain Number 2 Region: 150-185
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000000406
Family CCCH zinc finger 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002179   Gene: ENSPANG00000018603   Transcript: ENSPANT00000014988
Sequence length 437
Comment pep:known_by_projection chromosome:PapAnu2.0:13:42213916:42216196:-1 gene:ENSPANG00000018603 transcript:ENSPANT00000014988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTTLLSAFYDVDFLCKTEKSLANLNLNNMLDKKAVGTPVAAAPSSGFAPGFLRRHSASN
LHALAHPAPSPGSCSPKFPGAANGSSCGSAAAGGPTSYGTLKEPSGGGGTALLNKENKFR
DRSFSENGDRSQHLLHLQQQQKGGGGSQINSTRYKTELCRPFEESGTCKYGEKCQFAHGF
HELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNADERRPAPSGGASGDLRAFGTRD
ALHLGFPREPRPKLHHSLSFSGFPSGHHQPPGGLESPLLLDSPTSRTPPPCCASAAAAAA
AALLYGSGGAEDLLAPGAPCAACSSASCANNAFAFGPELSSLITPLAIQTHNFAAVAAAA
YYRSQQQQQQGLAPPALSFQLPRRLSDSPVFDADSLSDRDSYLSGSLSSGSLSGSESPSL
DPGRRLPIFSRLSISDD
Download sequence
Identical sequences ENSPANP00000002179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]