SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002202 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002202
Domain Number 1 Region: 75-234
Classification Level Classification E-value
Superfamily EF-hand 2.06e-27
Family Calmodulin-like 0.023
Further Details:      
 
Domain Number 2 Region: 210-296
Classification Level Classification E-value
Superfamily EF-hand 0.00000000658
Family Calmodulin-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002202   Gene: ENSPANG00000018409   Transcript: ENSPANT00000020007
Sequence length 312
Comment pep:known_by_projection chromosome:PapAnu2.0:14:32734575:32750916:-1 gene:ENSPANG00000018409 transcript:ENSPANT00000020007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARGGRGRRLGFALGLLLALVLAPRVLRAKPTVRKERVVRPDSELGERPPEDNQSFQYDH
EAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNV
AKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADL
DGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGP
EPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKVFPI
LLESLIEGRPFT
Download sequence
Identical sequences A0A096MR08
ENSPANP00000002202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]