SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002207 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002207
Domain Number 1 Region: 87-232
Classification Level Classification E-value
Superfamily EF-hand 5.55e-37
Family Calmodulin-like 0.000000489
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002207   Gene: ENSPANG00000010686   Transcript: ENSPANT00000009527
Sequence length 234
Comment pep:known_by_projection chromosome:PapAnu2.0:11:51739223:51742342:1 gene:ENSPANG00000010686 transcript:ENSPANT00000009527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGPRSWEMGRIGGERWEETGGGRGEGRGRRQREPEDPKGWRWGWKAPYPAGKRVCSLKQ
ECGAGIETRGIGVQMLTTSLFSEQCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMR
ALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFD
KEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEAFVRHILSG
Download sequence
Identical sequences ENSPANP00000002207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]