SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002215 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002215
Domain Number 1 Region: 298-486,774-921
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.3e-114
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.000000699
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000002215
Domain Number - Region: 10-122
Classification Level Classification E-value
Superfamily DUSP-like 0.000379
Family DUSP, domain in ubiquitin-specific proteases 0.00028
Further Details:      
 
Domain Number - Region: 151-220
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0387
Family Ubiquitin-related 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002215   Gene: ENSPANG00000019009   Transcript: ENSPANT00000004511
Sequence length 962
Comment pep:known_by_projection chromosome:PapAnu2.0:2:85989681:86057721:1 gene:ENSPANG00000019009 transcript:ENSPANT00000004511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGGGCRERPDAETQKSELGALMRTTLQRGAQWHVIYSCQVKQCNQTVCLDWDLYKDHY
EINDLPIDNSGLFSGIKSLQTLNEKLFDILNLVLVETEPHNKFNSEYYCLSGGYPLISKV
VEHGLFVKHCKVEVYLLELKLCENSDPTNVLSCHFSKADTIATIEKEMRKLFNIPAERET
RLWNKYMSNTYEQLSKLDNTVQDAGLYQGQVLVIEPQNEDGTWPRQTLQSKSSTAPSRNF
TTSPKSSASPYSSVSASPIANGDSTSTCGMHSSGVSRGGSGFSASYNCQEPPSSHIQPGL
CGLGNLGNTCFMNSALQCLSNTAPLTDYFLKDEYEAEINRDNPLGMKGEIAEAYAELIKQ
MWSGRDAHVAPRMFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRVKKKPYLELK
DANGRPDAVVAKEAWENHRLRNDSVIVDTFHGLFKSTLVCPECAKVSVTFDPFCYLTLPL
PLKKDRVMEVFLVPADPHCRPTQYRVTVPLMGAVSDLCEALSRLCGIAAENMVVADVYNH
RFHKIFQMDEGLNHIMPRDDIFVYQVCSTSMDGSECVTLPVYFRERKSRPSSTSSGSALY
GQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPLPDDFGSSPLEPGTCNGSRNSCEGEDE
EEMEHQEEGKEQLSETEGSGEDELGNDPTKTTQKKIKGQPCPKRLFTFSLVNSYGTADIN
SLATDGKLLKLNSRSTLAIDWDSETRSLYYDEQESEAYEKHVSMLQPQKKKKTTVALRDC
IELFTTMETLGEHDPWYCPNCKKHQQATKKFDLWSLPKILVVHLKRFSYNRYWRDKLDTV
VEFPIRGLNMSEFVCNPSARPYVYDLIAVSNHYGAMGVGHYTAYAKNKLNGKWYYFDDSN
VSLASEDQIVTKAAYVLFYQRRDDEFYKTPSLSSSGSSDGGTRPSSCQQGLGDDEACSMD
TN
Download sequence
Identical sequences ENSPANP00000002215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]