SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002247 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002247
Domain Number 1 Region: 126-168
Classification Level Classification E-value
Superfamily SAP domain 0.000000000000298
Family SAP domain 0.0086
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000002247
Domain Number - Region: 28-108
Classification Level Classification E-value
Superfamily Saposin 0.0144
Family NKL-like 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002247   Gene: ENSPANG00000024090   Transcript: ENSPANT00000014543
Sequence length 181
Comment pep:known_by_projection chromosome:PapAnu2.0:2:83937672:83941687:-1 gene:ENSPANG00000024090 transcript:ENSPANT00000014543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRMWATQGLAVALALSVLPGGRALRPGDCEVCISYLGRFYQDLKDRDVTFSPATIENELI
KFCREARGKENRLCYYIGATDDAATKIINEVSKPLAHHIPVEKICEKLKKKDSQICELKY
DKQIDLSTVDLKKLRVKELKKILDDWGETCKGCAEKSDYIRKINELMPKYAPKAASARTD
L
Download sequence
Identical sequences ENSPANP00000002247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]