SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002263 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002263
Domain Number 1 Region: 349-456
Classification Level Classification E-value
Superfamily SH2 domain 1.14e-31
Family SH2 domain 0.00000331
Further Details:      
 
Domain Number 2 Region: 55-162
Classification Level Classification E-value
Superfamily SH2 domain 6.73e-31
Family SH2 domain 0.00000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002263   Gene: ENSPANG00000008892   Transcript: ENSPANT00000022778
Sequence length 461
Comment pep:novel chromosome:PapAnu2.0:1:48305948:48400605:-1 gene:ENSPANG00000008892 transcript:ENSPANT00000022778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSAVTNGMKDSSVSL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDG
KYGFSDPLTFNSVVELINHYHHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKK
LQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEY
IERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQDLKKQALDNREIDKKMNSIKP
DLIQLRKIRDQHLVWLNHKGVRQKRLNAWLGIKNEDADENYFINEEDENLPHYDEKTWFV
EDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYN
LYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSLCR
Download sequence
Identical sequences A0A096MR68 A0A0D9S7F0 A0A2K5K2F3 A0A2K5MQ86 A0A2K5TJZ8 A0A2K5ZT21 A0A2K6JT33 A0A2K6QPZ6 H9G113
9544.ENSMMUP00000040267 ENSMMUP00000019764 ENSMMUP00000040267 NP_001253755.1.72884 XP_005543547.1.63531 XP_007977113.1.81039 XP_010361340.1.97406 XP_011802127.1.43180 XP_011934270.1.92194 XP_011934271.1.92194 XP_014993917.1.72884 XP_014993923.1.72884 XP_015292058.1.63531 XP_017737237.1.44346 XP_017737238.1.44346 XP_017737239.1.44346 ENSMMUP00000019764 ENSPANP00000002263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]