SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002265 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002265
Domain Number 1 Region: 56-203
Classification Level Classification E-value
Superfamily EF-hand 1.58e-34
Family Calmodulin-like 0.00000249
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002265   Gene: ENSPANG00000021040   Transcript: ENSPANT00000025020
Sequence length 205
Comment pep:known_by_projection chromosome:PapAnu2.0:2:88528787:88535338:1 gene:ENSPANG00000021040 transcript:ENSPANT00000025020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTGAPMAPKKPEPKKDDAKAAAKAAPAPAPAPAPPPEPERPKEVEFDASKIKIEFTPEQ
IEEFKEAFMLFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEELNTKMMD
FETFLPMLQHISKNKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGERLTEDEVE
KLMAGQEDSNGCINYEAFVKHIMAS
Download sequence
Identical sequences ENSPANP00000002265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]