SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002282 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002282
Domain Number 1 Region: 890-1026
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.47e-36
Family Synaptotagmin-like (S variant) 0.000000716
Further Details:      
 
Domain Number 2 Region: 1266-1397
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.44e-21
Family Synaptotagmin-like (S variant) 0.019
Further Details:      
 
Domain Number 3 Region: 689-786
Classification Level Classification E-value
Superfamily PDZ domain-like 4.07e-20
Family PDZ domain 0.00000592
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002282   Gene: ENSPANG00000026452   Transcript: ENSPANT00000025870
Sequence length 1401
Comment pep:known_by_projection chromosome:PapAnu2.0:3:119080005:119237114:1 gene:ENSPANG00000026452 transcript:ENSPANT00000025870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGINRRKEALLKEREKRERAYLQGVAEDRDYMSDSEVSSTRPARIESQHGIERPRTAPQT
EFSQFIPPQTQTESQLVPPTSPYTQYQYSSPALPTQAPTSYTQQSHFQQQTLYHQQVSPY
QTQPTFQAVATMSFTPQAQPTPTPQPSYQLPSQMMVIQQKPRQTTLYLEPKITSNYEVIR
NQPLMIAPVSTDNTYAVSHLGSKYNSLDLRIGLEERSSMASSPISSISADSFYADIDHHT
PRNYVLIDDIGEITKGTAALSTAFSLHEKDLSKTDRLLRTTETRRSQEVTDFLAPLQSSS
RLHSYVKAEEDPMEDPYELKLLKHQIKQEFRRGTESLDHLAGLSHYYHADTSYRHFPKSE
KYSISRLTLEKQAAKQLPAAILYQKQSKHKKSLIDPKMSKFSPIQESRDLEPDYSSYMTS
STSSIGGISSRARLLQDDITFGLRKNITDQQKFMGSSLGTGLGTLGNTIRSALQDEADKP
YSSGSRSRPSSRPSSVYGLDLSIKRDSSSSSLRLKAQEAEALDVSFSHASSSARTKPTSL
PISQSRGRIPIVAQNSEEESPLSPVGQPMGMARAAAGPLPPISADTRDQFGSSHSLPEVQ
QHMREESRTRGYDRDIAFIMDDFQHAMSDSEAYHLRREETDWFDKPRESRLENGHGLDRK
LPERLVHSRPLSQHQEQIIQMNGKTMHYIFPHARIKITRDSKDHTVSGNGLGIRIVGGKE
IPGHSGEIGAYIAKILPGGSAEQTGKLMEGMQVLEWNGIPLTSKTYEEVQSIISQQSGEA
EICVRLDLNMLSDSENSQHLELHEPPKAVDKAKSPGVDPKQLAAELQKVSLQQSPLVLSS
VVEKGSHVHSGPTSAGSSSVPSPGQPGSPSVSKKKHSSSKPTDATKVVSHPITGEIQLQI
NYDLGNLIIHILQARNLVPRDNNGYSDPFVKVYLLPGRGQVMVVQNASAEYKRRTKYVQK
SLNPEWNQTVIYKSISMEQLKKKTLEVTVWDYDRFSSNDFLGEVLIDLSSTSHLDNTPRW
YPLKEQTESIDHGKSHSSQSSQQSPKPSVIKSRSHGIFPDPSKDMQVPTIEKSHSSPGSS
KSSSEGHLRSHGPSRSQSKTSVTQTHLEDAGAAIAAAEAAVQQLRIQPTAHKSGQSNHAR
KQHRHSIAGVLPIQRTQSDNLPPPANGNQDQSQLALRKVMSDGPVKPEGAKPPNHRPAES
SVSTGSSGSSFGSGYSVDSEGSSSTAGETNLFPIPRIGKMGQNGQEPVKQPGVGVGLADT
EAKTQVMGEIKIALKKEMKTDGEQLIVEILQCRNITYKFKSPDHLPDLYVKIYVMNMSTQ
KKVIKKKTRVCRHDREPSFNETFRFSLSPAGHSLQILLFSNGGKFMKKTLIGEACIWLDK
VDLRKRIVNWHKLLVSPTQTH
Download sequence
Identical sequences ENSPANP00000002282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]