SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002335 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002335
Domain Number 1 Region: 319-558
Classification Level Classification E-value
Superfamily SIS domain 8.12e-62
Family double-SIS domain 0.0000403
Further Details:      
 
Domain Number 2 Region: 2-209,250-294
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 8.49e-55
Family Class II glutamine amidotransferases 0.0000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002335   Gene: ENSPANG00000016006   Transcript: ENSPANT00000008635
Sequence length 593
Comment pep:known_by_projection chromosome:PapAnu2.0:6:173555644:173601668:-1 gene:ENSPANG00000016006 transcript:ENSPANT00000008635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGIFAYMNYRVPRTRKEIFETLIKGLQRLEYRGYDSAGVAIDGNNDDVKERYIQLVKKR
GKVKALDEELYKQDSMDLKVEFETHFGIAHTRWATHGVPSAVNSHPQRSDKGNEFVVIHN
GIITNYKDLRKFLESKGYEFESETDTETIAKLIKYVFDNRETEDITFSTLVERVIQQLEG
AFALVFKSIHYPGEAVATRRGSPLLIGVRSKYKLSTEQIPILYRTCTLENVKNICKTRMK
RLDSSACLHAVGDKAVEFFFASDASAIIEHTNRVIFLEDDDIAAAADGKLSIHRVKRSAS
DDPSRAIQTLQMELQQIMKGNFSAFMQKEIFEQPESVFNTMRGRVNFETNTVLLGGLKDH
LKEIRRCRRLIVIGCGTSYHAAVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFF
ISQSGETADTLLALRYCKDRGALTVGVTNTVGSSISRETDCGVHINAGPEVGVASTKAYT
SQFISLVMFGLMMSEDRISLQNRRQEIIRGLRSLPELIKEVLSLEGKIHDLALELYTQRS
LLVMGRGYNYATCLEGALVSPHPRPPPPGGQAQETWRNQREGGQGVGLGEGRV
Download sequence
Identical sequences ENSPANP00000002335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]