SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002366 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002366
Domain Number 1 Region: 255-510
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.57e-63
Family Eukaryotic proteases 0.000000121
Further Details:      
 
Domain Number 2 Region: 46-163
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-22
Family Spermadhesin, CUB domain 0.00034
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000002366
Domain Number - Region: 217-263
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0293
Family Complement control module/SCR domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002366   Gene: ENSPANG00000000600   Transcript: ENSPANT00000016867
Sequence length 514
Comment pep:known_by_projection chromosome:PapAnu2.0:11:7258189:7273881:-1 gene:ENSPANG00000000600 transcript:ENSPANT00000016867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGPRVWGKYLWRSPHSTGCPGAMWWLLLWGVLQACPTGGSILLAQELPQQLTSPGYPEP
YRKGHESSTDIKAPEGFAVRLVFQDFDLEPSQDCAGDSVTISASGSDPSQFCGQQDSPLG
RPPGQREFVSPGRSLRLTFCTQPSSENKTVHLHKGFLALYQTVAALPRNNCVLHCLDILP
RKRINCVCLYSVNYSQPISEASRGSEAISAPGDNPAKVQNHCQEPYYQATAAGTLTGTNP
GTWKDRQDGEEVLQCMPVCGRPVTPIAQNQTTLRSSRAKLGNFPWQAFTSIHGRGGGALL
GDRWILTAAHTIYPKDSVSLRKNRSVNVFLGHTAIDEMLKLGNHPVRRVIVHPDYRQNES
HNFSGDIALLELQHSIPLGPNVLPVCLPDNETLYRSGLLGYVSGFGVEMGWLTTELKYSR
LPVAPREACEAWLRKRQRPEVFSDDMFCVGDETQRHSVCQGDSGSVYVVWDDRAHHWVAT
GIVSWGIGCGEGYDFYTKVLSYVDWIKGVMNGKN
Download sequence
Identical sequences ENSPANP00000002366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]