SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002378 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002378
Domain Number 1 Region: 11-152
Classification Level Classification E-value
Superfamily Nucleoside diphosphate kinase, NDK 7.73e-46
Family Nucleoside diphosphate kinase, NDK 0.00025
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000002378
Domain Number - Region: 157-194
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0105
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002378   Gene: ENSPANG00000001335   Transcript: ENSPANT00000021967
Sequence length 212
Comment pep:known_by_projection chromosome:PapAnu2.0:6:131654758:131679071:-1 gene:ENSPANG00000001335 transcript:ENSPANT00000021967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEISMPPPQIYVEKTLAIIKPDIVDKEEEIQDIILRSGFTIVQRRKLHLSPEQCSNFYVE
QYGKMFFPNLTAYMSSGPLVTMILARHKAISYWLELLGPNNSLVAKETHPDSLRAIYGTD
DLRNALHGSNDFAAAEREIHFMFPEVIVEPIPIGQAAKDYLNLHIMPTLLEGLTELCKQK
PADPLIWLADWLLKNNPNKPKLCHHPIVEEPY
Download sequence
Identical sequences A0A096MRH7
ENSPANP00000002378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]