SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002404 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000002404
Domain Number - Region: 14-69
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00523
Family beta-sandwich domain of Sec23/24 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002404   Gene: ENSPANG00000022974   Transcript: ENSPANT00000008202
Sequence length 311
Comment pep:known_by_projection chromosome:PapAnu2.0:12:80160461:80167089:-1 gene:ENSPANG00000022974 transcript:ENSPANT00000008202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNPSAPPPYEDRNPLYPGPPPPGGYGQPSVLPGGYPAYPGYPQPGYGHPAGYPQPMPPI
HPMPMNYGPGHGYDGEERAVSDSFGPGEWDDRKVRHTFIRKVYSIISVQLLITVAIIAIF
TFVEPVSAFVRRNVAVYYVSYAVFVVTYLILACCQGPRRRFPWNIILLTLFTFAMGFMTG
TISSMYQTKAVIIAMIITAVVSISVTIFCFQTKVDFTSCTGLFCVLGIVLMVTGIVTSIV
LYFKYVYWLHMLYAALGAICFTLFLAYDTQLVLGNRKHTISPEDYITGALQIYTDIIYIF
TFVLQLMGDRN
Download sequence
Identical sequences A0A096MRK2 A0A1D5RCS1 A0A2K5LN53 A0A2K6AGI4 A0A2K6C4N5
ENSMMUP00000030044 NP_001253458.1.72884 XP_011738908.1.29376 XP_011738909.1.29376 XP_011738910.1.29376 XP_011819976.1.47321 XP_011819977.1.47321 XP_011819978.1.47321 XP_011918341.1.92194 XP_011918342.1.92194 XP_011918343.1.92194 XP_014966456.1.72884 XP_014966457.1.72884 ENSMMUP00000030044 9544.ENSMMUP00000030044 ENSPANP00000002404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]