SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002410 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002410
Domain Number 1 Region: 5-223
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.24e-50
Family LplA-like 0.0000551
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002410   Gene: ENSPANG00000007954   Transcript: ENSPANT00000025699
Sequence length 231
Comment pep:known_by_projection chromosome:PapAnu2.0:14:64340679:64343122:-1 gene:ENSPANG00000007954 transcript:ENSPANT00000025699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQPAVRLVRLGRVPYAELLGLQDRWLRRLQAEPGTEASSGTEAGALLLCEPAGPVYTAG
LRGGLTPEETARLRALGAEVRVTGRGGLATFHGPGQLLCHPVLDLRRLGLRLRMHVAALE
ACAVRLCELQGLQDARARSPPYTGVWLDDRKICAIGVRCGRHITSHGLALNCSTDLTWFE
HIVPCGLVGTGVTSLSKELQRHVTVDEVMPPFLVAFKEIYKCTLISEDSPN
Download sequence
Identical sequences A0A096MRK8
ENSPANP00000002410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]