SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002413 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002413
Domain Number 1 Region: 149-276
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.7e-46
Family Regulator of G-protein signaling, RGS 0.000000232
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002413   Gene: ENSPANG00000015543   Transcript: ENSPANT00000014576
Sequence length 302
Comment pep:known_by_projection chromosome:PapAnu2.0:1:186210650:186216674:1 gene:ENSPANG00000015543 transcript:ENSPANT00000014576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYHMMLLIQKRKGTGSQLLRAGEAEGDRGAGTAELSSDWLDRRSWAIKETPTGLGGRRSE
DSDNIFTGEEAKYAQSRSHSSSCRISFLLANPKLLNKMCKGLAGLPASCLRSAKDMKHRL
GFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWAESLENLISHECGLAAFKAFLKSE
YSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLQ
PTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASLVPQ
CA
Download sequence
Identical sequences A0A096MRL1
ENSPANP00000002413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]