SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002418 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002418
Domain Number 1 Region: 145-184,240-286
Classification Level Classification E-value
Superfamily TPR-like 0.000000012
Family Tetratricopeptide repeat (TPR) 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002418   Gene: ENSPANG00000011829   Transcript: ENSPANT00000012588
Sequence length 315
Comment pep:known_by_projection chromosome:PapAnu2.0:8:82068942:82104150:-1 gene:ENSPANG00000011829 transcript:ENSPANT00000012588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVAARLWRFLPLRRGAAPGPRLPAGTSGSRGHCGRCRFRGFEVMGNPGTFKRGLLLSAL
SYWGFETYQVISQAAVVHAAAKVEEILEQADYLYESGETEKLYQLLTQYKESEDAELLWR
LARASRDVAQLSRTSEEEKKLLVYEALEYAKRALQKNESHFAAHKWYAICLSDVGDYEGI
KAKIANAYIIKEHFEKRLSKNRKDFLSIYCKDLWRCYTFAEMPWYQRRIAEMLFATPPSS
TYEKALGYFHRAEQVDPNFYSKNLLLLGKTYLKLHNKKLAAFWLMKAKDYPAHTEEDKQI
QTEAAQLLTSFSEKN
Download sequence
Identical sequences ENSPANP00000002418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]