SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002457 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002457
Domain Number 1 Region: 5-351
Classification Level Classification E-value
Superfamily Cysteine proteinases 9.81e-138
Family Calpain large subunit, catalytic domain (domain II) 0.000000000109
Further Details:      
 
Domain Number 2 Region: 356-378
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 0.0000118
Family Calpain large subunit, middle domain (domain III) 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002457   Gene: ENSPANG00000005933   Transcript: ENSPANT00000004241
Sequence length 381
Comment pep:known_by_projection chromosome:PapAnu2.0:1:141497142:141543426:1 gene:ENSPANG00000005933 transcript:ENSPANT00000004241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAQAARVSRQRAAAQGLGSNQKALKYLGQDFKTLRQQCLDSGVLFKDPEFPACPSALGY
KDLGPGSPQTQGIIWKRPTELCPSPQFIIGGATRTDICQGGLGDCWLLAAIASLTLNEEL
LYRVVPRDQNFQENYAGIFHFQFWQYGEWVEVVIDDRLPTKNGQLLFLHSEQGNEFWSAL
LEKAYAKLNGCYEALAGGSTVEGFEDFTGGISEFYDLKKPPANLYQIIRKALRAGSLLGC
SIDVSSAAEAEAITSRKLVKSHAYSVTGVEEVDFQGHPERLIRLRNPWGEVEWSGAWSDD
APEWNHIDPQRKEELDKKVEDGEFWMSFSDFVRQFSRLEICNLSPDSLSSEEVHKWNLVL
FNGRWTRGSTAGGCQNYPGSS
Download sequence
Identical sequences A0A096MRQ5
ENSPANP00000002457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]