SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002479 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002479
Domain Number 1 Region: 271-388
Classification Level Classification E-value
Superfamily TPR-like 8.35e-19
Family Tetratricopeptide repeat (TPR) 0.023
Further Details:      
 
Domain Number 2 Region: 122-265
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000734
Family Tetratricopeptide repeat (TPR) 0.029
Further Details:      
 
Domain Number 3 Region: 30-152
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000171
Family Tetratricopeptide repeat (TPR) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002479   Gene: ENSPANG00000018151   Transcript: ENSPANT00000026509
Sequence length 535
Comment pep:known_by_projection chromosome:PapAnu2.0:1:130468914:130475543:1 gene:ENSPANG00000018151 transcript:ENSPANT00000026509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPNPEDVPQRPEPEPSSSNQTKKKRKWLWQEASIQALTRAGHGALQAGRNHEALNNFQ
RAFLLASKTPQTGDTLVLRACAFNLGAAYVETGDPARGLELLLRAHPEEKAQGRRHGDQC
FNVALAYHALGELPQALAWYHRALGHYQPQGDQGEAWAKMGACYQALGQPELAAHCLQEA
SRAYVQERQLQAAALALGAAAGCMLKSGRHRVGEVVQVLEKSQRLAERSTERGLLGHLYN
DLGLGYCQLRLFPLAVEAFLQALPLCWVPGEQATVLRNLGMAHNALGNYREAQEFHQKAA
DLHGSVGQRWEQGRSFGSLAFALSQLGDHKAARDNYLHALQAARDSGDMKGQWQACEGLG
AAAARLGQYDQALKYYKEALAQCQKEPDSVRERLVAKLADTVRTHLAQTSAPGRLQAPGG
ASQVEGTPAKAGSSAAGAQHRSSSGWEDEESEEGHQEKKEERSANVPMRAGPGRLERPGP
RAHFPFVGRGPPRAEYPSILVPNGPQVNRSSKWPRESLSRSCQRRPMESGICTIV
Download sequence
Identical sequences ENSPANP00000002479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]