SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002481 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002481
Domain Number 1 Region: 1621-1696
Classification Level Classification E-value
Superfamily PAH2 domain 0.0000000000000419
Family PAH2 domain 0.0042
Further Details:      
 
Domain Number 2 Region: 1706-1777
Classification Level Classification E-value
Superfamily PAH2 domain 0.000000000000183
Family PAH2 domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000002481
Domain Number - Region: 632-704
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0575
Family FCH domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002481   Gene: ENSPANG00000011456   Transcript: ENSPANT00000016222
Sequence length 2504
Comment pep:known_by_projection chromosome:PapAnu2.0:1:129510313:129713293:-1 gene:ENSPANG00000011456 transcript:ENSPANT00000016222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPCKKRRTTVTESLQHKGNQEENNVDLESAVKAESDQVKDLRSVSLSWDPSHGRVAGFE
VQSVQDAGNQLGMEDTSLSSGMLTQDTNVPILESVDVAISQGITLPSLESFHPLNIHIGK
GKLQATGSKRGKKITLRPGPVTQEDRRDHPILKEPFSEEPSEEVKEEGGKPQMHSEGELP
SLPSGSQSAKPVSQPRKSTQPDVCASPQEKPLRTLFHQPEEEIEDGGLFIPMEEQDNEES
EKRRKKKKGTKRKRDGRGQEGTLAYDLKLDDMLDRTLEDGAKQHNLTAVNVRNILHEVIT
NEHVVAMMKAAISESEDMPMFEPKMTRSKLKEVVEKGVVIPTWNISPIKKANEIKPPQFV
DIHLEEDDSSDEEYQPDDEEEDETAEESLLESDVESTASSPRGAKKSRLRQSSEMTETDE
ESGILSEVEKVTTPAIRHISAEVVPMGPPPPPKPKQTRDSTFMEKLHAVDEELASSPVCM
DSFQSMDDSLIAFRTRSKMPLKDVPLGQLEAELQAPDITPDMYDPNTADDEDWKMWLGGL
MNDDVGNEDEADDDDDPEYNFLEDLDEPDTEDFRTDRAVRITKKEVNELMEELFETFQDE
MGFSNMEDDGPEEEERVAEPRPNFNTPQALRFEEPLANLLNEQHRTVKELFEQLKMKKSS
AKQLQEVEKVKPQNEKVHQTLILDPAQRKRLQQQMQQHVQLLTQIHLLATCNPNLSPEAS
TTRIFLKELGTFAQSSIALHHQYNPKFQTLFQPCNLMGAMQLIEDFSTHVSIDCSPHKTV
KKTANEFPCLPKQVAWILATSKVFMYPELLPVCSLKAKNPQDKIVFTKAEDNLLALGLKH
FEGTEFPNPLISKYLLTCKTAHQLTVRIKNLNMNRAPDNIIKFYKKTKQLPVLVKCCEEI
QPHQWKPPIEREEHRLPFWLKASLPSIQEELRHMADSAREVGHVTGTTEINSDHGLEKDN
SELESETRYPLLLPKGVVLKLKPVATRFPRKAWRQKRSSVLKPLLIQPSPSLQPSFNPGK
TPARSTHSEAPPSKMVLRIPHLIQPATVLQTVPGVPPLAVSGGESFESPAALPAMPPEGR
TSFPLSESQTLLSSAPVPKVMLPSLAPSKFRKPYVRRRPSKRRGIKASPCMKPTPVIHHP
ASVIFTVPATTVKIVSLGSGCNMIQPVNAAVAQSPQTIPITTLLVNPTSFPCQLNQPLMA
SSVSPLIVSGNSVNLPIPSTPEDKAHVNVDIACAVANGENAFQGLEPKLEPQELSPLSAT
VFPKVEHSPGPPSADAECQEGLSENSACRWTVVKTEEGRQALEPLPQGIQESVNNSSSGD
LEEVVKVEPEDAREEISGSPERDICDDIKEEHAVELDTGVTSEDLNSAREVKKQTVLQKE
EERSQPAKTPSSSQEHPDEGTSGTDVNKGSSKNALSSMDPEVRLSSPPGKPEESPSVDGQ
SVETPVGPETGGEKNGPEEEEEEDFDDLTQDEEDEMSSASEESVLSVPELQETMEKLTWL
ASERRMSQEGESEEENSQEENSEPEEEEEEEAEGMESLQKEDEMMDEAVGDSAEKPPSTF
ASSETAPEVETSRTPPGESIKAAGKGRNNHRARNKRGSRARASKDTSKLLLLYDEDILER
DPLREQKDLAFAQAYLTRVREALQHIPGKYEDFLQVIYEFESSTQRQTAVDLYKSLQILL
QDWPQLLKDFAAFLLPEQALACGLFEEQQAFEKSRKFLRQLEICFAENPSHHQKIIKVLQ
GCADCLPQEITELKTQMWQLLKGHDHLQDEFSIFFDHLRPAASRMGDFEEINWTEEKEYE
FDGFEEVALPDVEEEEEPPKIPTASKNKRKKEIGVQNHDKETEWPDGTKDCACSCHEGGP
DSKLKKSKRRSCSHCSSKVCDSKSYKSKEPHELVGSSPHREASPMPGTKEAGQGKDVTEE
EAPEERESTEATQSRTVRTTRKGEMPVSANEFPCLPKQVAWILATSKVFMYPELLPVCSL
KAKNPQDKILFTKAEDNLLALGLKHFEGTEFLNPLISKYLLTCKTARQLTVRIKNLNMNR
APDNIIKFYKKTKQLPVLVKCCEEIQPHQWKPPVEREEHRLPFWLKASLPSIQEELRHMA
DGAREVGHVTGTTEINSDQGLEKDNSELESETQYPLLLPKGVVLKLKPVANRFPRKAWRQ
KRSSVLKPLLIQPSPCLQPSFNPGKTPAQSTHSEAPPSKMVLRIPHPIQPATVLPTVPGV
SPLGVSGGESFESPAALPAMPPEGRTSFPLSESQTLLSSAPVPKVMLPSPSPSMFRKPYV
RRRPSKRRGARAFRCIKPAPVIHPASVIFTVPATTVKIVSLGSGCNMIQPVHAAVAQSPQ
TIPITTLLVNPTSFPCQLNQPLVASSVSPLIVSGNSVNLPIPSTPEDKAHVNVDIACAVA
NGENAFQGLEPKLEPQELSPLSATVFPKVEHSPGPPPADAECQEGLSENSAYRWTVVKTE
EGRQALEPLPQGIQESVNNSSPGDLEEVVKMEPEDATEEISGFP
Download sequence
Identical sequences ENSPANP00000002481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]