SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002486 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002486
Domain Number 1 Region: 51-155
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.2e-32
Family Spermadhesin, CUB domain 0.00019
Further Details:      
 
Domain Number 2 Region: 170-294
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.29e-19
Family Spermadhesin, CUB domain 0.0045
Further Details:      
 
Domain Number 3 Region: 292-328
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000327
Family LDL receptor-like module 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002486   Gene: ENSPANG00000000411   Transcript: ENSPANT00000022779
Sequence length 534
Comment pep:known_by_projection chromosome:PapAnu2.0:18:64982627:65101053:-1 gene:ENSPANG00000000411 transcript:ENSPANT00000022779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIHGRSVLHIVASLIILHLSGATKKGTAEKQTTSETQKSVQCGTWTKHAEGGIFTSPNYP
SKYPPDRECIYIIEAAPRQCIELYFDEKYSIEPSWECKFDHIEVRDGPFGFSPIIGRFCG
QQNPPVIKSSGRFLWIKFFADGELESMGFSARYNFTPDPDFKDLGALKPLPACEFEMGGS
EGIVESVQIMKEGKATASEAVDCKWYIRAPPRSKIYLRFLDYEMQNSNECKRNFVAVYDG
SSSVEDLKAKFCSTVANDVMLRTGLGVIRMWADEGSRNSRFQMLFTSFQEPPCEGNTFFC
HSNMCINNTLVCNGLQNCVYPWDENHCKEKRKTSLLDQLTNTSGTVIGVTSCIVIILIII
SVIVQIKQPRKKYVQRKSDFDQTVFQEVFEPPHYELCTLRGTGATADFADVADDFENYHK
LRRSSSKCIHDHHCGSQLSSTKGSRSNLSTRDASILTEMPTQPGKPLIPPMNRRNILVMK
HNYSQDAADACDIDEIEEVPTTSHRLSRHDKAVQRFCLIGSLSKHESEYNTTRV
Download sequence
Identical sequences ENSPANP00000002486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]