SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002510 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002510
Domain Number 1 Region: 202-242
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000665
Family Erythroid transcription factor GATA-1 0.0066
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000002510
Domain Number - Region: 234-262
Classification Level Classification E-value
Superfamily NOB1 zinc finger-like 0.068
Family NOB1 zinc finger-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002510   Gene: ENSPANG00000005034   Transcript: ENSPANT00000020802
Sequence length 271
Comment pep:known_by_projection chromosome:PapAnu2.0:19:9245446:9250378:-1 gene:ENSPANG00000005034 transcript:ENSPANT00000020802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEPQVECVAAPGYTKSRPKFGSPWPDKPRSHPRKSDPTALLPRSLWPACQDSVTALRFL
QETVERLGQSPTQDTPVLGPCWDPMALGTQGRLLLDRDSKDTQTPISQKDRRLQPPGTHP
APPQRRPRKQPNPCRGTEEVDPGFEGVTLTFQIKPDSSLQIIPTYSLPCSSRSQESPADA
VGGPAAHPRGTEAHSAGSEALEPRRCASCQTQRTPLWRDAEDGTPLCNACGIRYKKYGTR
CSSCWLVPRKNVQPKRLCGRCGVSLDPIQEG
Download sequence
Identical sequences A0A0A0MUN8
ENSPANP00000002510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]