SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002575 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002575
Domain Number 1 Region: 25-281
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.74e-51
Family Rhodopsin-like 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002575   Gene: ENSPANG00000002471   Transcript: ENSPANT00000010044
Sequence length 292
Comment pep:known_by_projection chromosome:PapAnu2.0:6:145918225:145925426:-1 gene:ENSPANG00000002471 transcript:ENSPANT00000010044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGMEKLQNASWIYQQKLKDPFQKHLNSTEEYLAFLCGPRRSHFFLPVSVVYVPIFVVGV
IGNVLVCLVILQHQAMKTPTNYYLFSLAVSDLLVLLLGMPLEVYEMWRNYPFLFGPVGCY
FKTALFETVCFASILSITAISVERYVAILHPFRAKLESTRRRAVRILGIVWGFSMLFSLP
NTSIHGIKFHYFPNGSLVPGSATCTVIKPMWIYNFIIQVTSFLFYFLPMTVISVLYYLMA
LRLKKDKSLEAHEGNANIQRPCRKSVNKMLCKCSILVFVLFCSQEQRSYIWY
Download sequence
Identical sequences ENSPANP00000002575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]