SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002617 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002617
Domain Number 1 Region: 162-327
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.73e-46
Family BCR-homology GTPase activation domain (BH-domain) 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002617   Gene: ENSPANG00000008472   Transcript: ENSPANT00000015670
Sequence length 612
Comment pep:known_by_projection chromosome:PapAnu2.0:18:3999981:4024236:-1 gene:ENSPANG00000008472 transcript:ENSPANT00000015670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTECFLPPTSSPSEHRRVEHGSGLTRTPSSEEISPTKFPGLYRTGEPSPPHDILHEPPDI
VSDDKVDIVHFIGTFNKNSLQAEGYAAFQEDSSGDEAESPSKMKRSKGIHVFKKPSFLTA
ADVVKQWKPIQEPEVPQIDVPNLKPIFGIPLADAVERTMMYDGIRLPAVFRECIDYVEKY
GMKCEGIYRVSGIKSKVDELKAAYDREESTNLEEYEPNTVASLLKQYLRDLPENLLTKEL
MPRFEEACGRTTETEKVQEFQRLLKELPECNYLLISWLIVHMDHVIAKELETKMNIQNIS
IVLSPTVQISNRVLYVFFTHVQELFGNVVLKQVTKPLRWSNMATMPTLPETQAGIKEEIR
RQEFLLNCLHRDLQGGIKDLSKEERLWEVQRILTALKRKLREAKRQECETKIAQEIASLS
KEDVSKEEMNENEEVINILLAQENEILTEQEELLAMEQFLRRQIASEKEEIERLRAEIAE
IQSRQQHGRSETEEYSSESESESEDEEELQIILEDLQRQNEELEIKNNHLNQAIHEEREA
IIELRVQLRLLQMQRAKAEQQAQEDQEPEWRGGAVQPPRDGVLEPKAAKEQPKAGKEPAK
PSPSRDRKETSI
Download sequence
Identical sequences ENSPANP00000002617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]