SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002642 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002642
Domain Number 1 Region: 144-259
Classification Level Classification E-value
Superfamily C-type lectin-like 5.67e-42
Family Link domain 0.0025
Further Details:      
 
Domain Number 2 Region: 3063-3221
Classification Level Classification E-value
Superfamily C-type lectin-like 2.97e-41
Family C-type lectin domain 0.00000564
Further Details:      
 
Domain Number 3 Region: 252-353
Classification Level Classification E-value
Superfamily C-type lectin-like 3.88e-30
Family Link domain 0.0029
Further Details:      
 
Domain Number 4 Region: 29-147
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000868
Family V set domains (antibody variable domain-like) 0.013
Further Details:      
 
Domain Number 5 Region: 3222-3280
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000122
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 6 Region: 3019-3059
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000286
Family EGF-type module 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002642   Gene: ENSPANG00000000300   Transcript: ENSPANT00000025538
Sequence length 3324
Comment pep:known_by_projection chromosome:PapAnu2.0:6:77495848:77609846:1 gene:ENSPANG00000000300 transcript:ENSPANT00000025538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLININSILWMCSTLIATHALHKVKVGKSPPLRGSLSGKVSLPCHFSTMPTLPPGYNTSE
FLRIKWSKIEVDKNGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEAVGDASLTVVKL
LASDAGLYRCDVMYGIDDTQDTVSLAVDGVVFHYRASTSRYTLNFEAAQKACLDIGAVIA
TPEQLFAAYEDGFEQCDAGWLADQTVRYPIRAPRVGCYGDMMGKAGVRTYGFRSPQETYD
VYCYVDHLDGDVFHLTAPSKFTFEEAAKECENQDARLATVGELQAAWRNGFDQCDYGWLS
DASVRHPVTVARAQCGGGLLGVRTLYRFENQTGFPPPDSRFDAYCFKPKEATTIDLSILA
ETASPSLSKEPQMVSDRTTPIIPLVDELPVIPTEFPPVGNIVDFEQKATVQPQAVTDSLA
TKLPIPTGSSKKPWDMDDYSPSASGPLGKPDISEFKDEVLQSTTVVSHYATDSWDGVVED
TQTQESVTQIEQIEVGPLVTSMEILKHIPSKEFPVTETPLVTGRMTLESKTEKKTVSTVS
ELVTTGHYGFTLGEEDDEDRTLPVGSDESTLIFDQTPEVITASKTSEDTTDTQLEDLETV
LASTTVLPLIMPDNNGSSMDDWEQRETNGRITEDFFGKYLSTTPFPSQHHTEIELFPYSG
DKILVEGISTVIYPSPQTEMTHRRERTETLIPEMRTDTYTDEIQEEITKSPFMGKTEEED
FSGMKLSTSPSEPIHVTESSVEMTKSFDFPTLTTKLSAEPTEVRDMEEEFTATPGTIKYD
ENTTTVHLTHSTLSVEAATISKWSWDEDNITSKPLESTEPSTSSKLPPALLTTVGMNGKD
KEIPSFTEDGADEFTLIPDSTQKQLEEITDEDIAVHGKFTVRFQPTTSIGIAEKSTLRDS
ITEEKVPPITSTEGRVYATMEGSTLGEVEDVDLSKSVSTVPQLAHTSEAEGLAFVSYSST
QEPTTYVDSSHTIPFSVIPKTDWGVLIPSVPSEDEVLGEPSQDIRVIDQTHLEVTISPET
IRTTKLTEETTQEEFPWKEQTAEKPVPALSSTAWTPKEAVTPLDEQEGDGSAYTVSEDEL
LTGSERVPVLETTPVGKIDHSVSYPPGAITEQKVKTVEVVTLTPSIGPKVSISPGPEQKY
ETERSSTTGFTSSLSPFSTHVTQLMEETTTEKISLEDIDLGSGLFEKPKATELIEFSTIK
ATVPSDITTAFSSVDRLHTTSALKPSSAITKKPPLIDREPGEETTSDMVIIGESTSHVPP
TTLEDIVAKETETDIDREYFTTSSPPTTQPTRPPTVEDKEAFGPQALSTPQPPARTKFHP
DINVYIIEVRENKTGRMSDLSVIGHPIDSESKEDEPCSEETDPVHDLMAEILPEFPDIIE
IDLYHSEENEEEEECANATDVTTTPSVQYINGKHLVTTVPKDPEAAEARRGQFESVAPSQ
NFSDSSESDTRPFVIAETELSTAVQPNGSTETTESLEITWKPETYPETSEHFSGGEPDVF
PTVPFHEEFESGTAIKGAESVTERDTEVGHQAHEHIETVSLFPEESSGEIAIDQESQKIA
FARPTEVTFGEEVEKSTSVTYTPTVVPSSASAYVSEEKAVTLIGNLWPDDLLSTKESWVE
ATPRQVVELSGSSSIPVTEGSGEAEEDEDTMFTMVTDLSQRNTTDTLITLDTSRIITEGF
FEVPATAIYSVSEQPSAKVVPTQFVSETDTSEWISSTSAEEEKRKEEEGTTGTASTVEEY
SPTQRSDQLILPSELESSNVVVSNDSGTRKSFMSLTTPTQSEREMTDSTLVFTETNTLEN
LEAQTTEHSSIHQSGVQEGLTTLPGSPASLFMEQGSGEAAADPETTTVSSFSLNLEYEIQ
AKKEAAGTLSPYVETTFSTEPTELVMSTVMDREVAENISQISREILISERLGEPNHGAEI
RGFSTGFPLEEFSGDFKEYSTVSHPIAKEETVMMEGSGDAAFRDTQTSPSTVLTSVHISH
ISDSEGPSSTMVSTSAFPWEEFTSSAEGSGEQLVTVSSSVDPALPSAIGRFSGTASSIID
EGLGEVGTVNEIDRRSTILPTAEVEGTKAPVEKEEVKVSGTISTNFPQTMEPAKLWSRQE
VNPERQEIESETTSEEQIQEEKSFESPQNSPTTEQTIFDSQTFTETELKTTGYSVLTTKK
TYSDDKEMEEEGTSLANMSTPDPVANGMESFTTLPEATEKSHFFLATTLVTESIPAEHVV
TDSPIKEEESTKHFPKSMRPTIQELDTELLFSGLGSGEEVLPTLPTKSVDFTEVEQIRNT
FYPHSSQVESTSSDKTEDSNRMENVAKEVGPLVSQTDIFEGNESVTSTTLIEILSDTGAE
GPTVAPLPFSGHIGHPQNQTLRWAEEIQTSRPQTITEQDSNKNSSTAEINETTTSSTDFL
ARVYGFEMAKEFVTSAPKPSDMFYEPSGEGSGEADIVDSFHTSATTQATRQESSTMFVSD
GSLEKHPEVPSTKAVTADGFPTISAMLPFHSEQNKSSPDPTSTLSNTVSYERSTDGSFQD
HFREFEDSTLKPNRKKPTENIIIDLDKEDKDLILTITESTILEILPELTSDKNTIIDIDH
TKPVYEDILGMQTDIDPEVPSEPHDSNDESNDDSTQVQETYEAAVNLSLTEETFEGSGDV
LLASYTQATHDESMTYEDRSQLDHMDFNFTTGIPAPSTETELDILLPTATSLPIPRKSAT
VIPETEEIKAEAKALDDMFESSTLSDGQAIADQSEIIPTLGQFERTQEEYEDKKHAGPSF
QPEFSSGVEEALVDHTPYLSIATTHLVDESLTEVPNVMEGSNAPYYTDTTLAVSAFAKLS
SQTPSSPLTIYSGSEASGHTEIPQPSALPGIDVGSSVMSPEDSFKEIHVNIEATFKPSSE
EYLHITEPPSISPDTKLEPSEEDGKPELLEEMEASPTEFIAVEGXTSERPTLSSSPEINP
ETQAALIRGQDSTVAASEQQVAARILDSNNQATVSPVEFNTEVATPPFSLLETSNETDFL
IGINEESVEGTAIYLPGPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECH
SNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDA
AERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRP
NQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMK
PRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMNPSAYQRTYSMKYFKNSSS
AKDNSINTSKHDHRWSRRWQETRR
Download sequence
Identical sequences ENSPANP00000002642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]