SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002689 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002689
Domain Number 1 Region: 143-275
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.18e-43
Family Synaptotagmin-like (S variant) 0.00000083
Further Details:      
 
Domain Number 2 Region: 282-417
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.32e-42
Family Synaptotagmin-like (S variant) 0.000000507
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002689   Gene: ENSPANG00000009048   Transcript: ENSPANT00000020111
Sequence length 430
Comment pep:known_by_projection chromosome:PapAnu2.0:11:74565220:74869355:1 gene:ENSPANG00000009048 transcript:ENSPANT00000020111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKASPEPKMVSESHHEALAAPPVTTVATVLPSNATEPASPGEGKEDAFSKLKEKFMNELH
KIPLPPWALIAIAIVAVLLVLTCCFCICKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGK
TMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPAL
DMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDF
DRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTV
VILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQ
IQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEE
EVDAMLAVKK
Download sequence
Identical sequences ENSPANP00000002689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]