SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002703 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002703
Domain Number 1 Region: 409-693
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-82
Family Protein kinases, catalytic subunit 0.000000000128
Further Details:      
 
Domain Number 2 Region: 908-1046
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 1.44e-59
Family FAT domain of focal adhesion kinase 0.000000167
Further Details:      
 
Domain Number 3 Region: 132-253
Classification Level Classification E-value
Superfamily Second domain of FERM 1.27e-39
Family Second domain of FERM 0.000000406
Further Details:      
 
Domain Number 4 Region: 31-130
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.45e-39
Family First domain of FERM 0.00000275
Further Details:      
 
Domain Number 5 Region: 254-362
Classification Level Classification E-value
Superfamily PH domain-like 4.67e-37
Family Third domain of FERM 0.00000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002703   Gene: ENSPANG00000015685   Transcript: ENSPANT00000004330
Sequence length 1052
Comment pep:known_by_projection chromosome:PapAnu2.0:8:135500279:135816263:-1 gene:ENSPANG00000015685 transcript:ENSPANT00000004330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAYLDPNLNHTPNSSTKTHLGTGMERSPGAMERVLKVFHYFESNSEPTTWASIIRHGD
ATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEW
KYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMLEIADQVDQEIALKLGCLEIRRSY
WEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESI
LKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFTQVQ
TIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGASQSFII
RPQKEGERALPSIPKLANSEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRE
RIELGRCIGEGQFGDVHQGIYMSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDH
PHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESK
RFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFT
SASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWA
YDPSRRPRFTELKAQLSTILEEEKAQQEERMRMESRRQATVSWDSGGSDEAPPKPSRPGY
PSPRSSEGFYPSPQHMVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQTDSWNHRPQE
IAMWQPNVEDSTALDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLS
RGSIDREDGSLQGPIGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPADSYNE
GVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLA
LRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQM
LTAAHALAVDAKNLLDVIDQARLKMLGQTRPH
Download sequence
Identical sequences ENSPANP00000002703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]