SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002736 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002736
Domain Number 1 Region: 334-454
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000113
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 2 Region: 214-327
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000471
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 160-208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000016
Family EGF-type module 0.01
Further Details:      
 
Domain Number 4 Region: 422-452,509-604
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000138
Family Growth factor receptor domain 0.0062
Further Details:      
 
Domain Number 5 Region: 127-169
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000282
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000002736
Domain Number - Region: 1044-1077
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0684
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 874-920
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0887
Family Laminin-type module 0.047
Further Details:      
 
Domain Number - Region: 790-833
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0949
Family Laminin-type module 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002736   Gene: ENSPANG00000009524   Transcript: ENSPANT00000008617
Sequence length 1542
Comment pep:known_by_projection chromosome:PapAnu2.0:1:6334843:6454404:-1 gene:ENSPANG00000009524 transcript:ENSPANT00000008617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFLEEASAAGRTVALALVLLLLPAVPVGASVPPRPLIPLQPSMPHVCAEQELTLVGRRQ
PCVQAFSHTVPVWKAGCGWQAWCVGHERRTVYYMGYRQVYTTETRTVLRCCRGWTQQPGE
QGCLSAECSAGFCFHGGRCAPGSAQPCHCPSGFQGPRCQYDVDECRTHNGGCQQRCVNTL
GSYLCECKPGFRLHTDSRTCLDETPCATPGKSGCQHHCVQLTITRHRCQCRPGFQLQEDG
RRCVRRSPCADRNGGCMHRCQVVRGLAHCECHAGYQLAADGKACEDVDECAAGLAQCAHG
CLNTQGSFKCVCHTGYELGADGRQCYRIEMEIVNSCEANNGGCSHGCSHTSAGPLCTCPR
GYELDTDQRTCIDVDDCADSPCCQQVCTNNPGGYECGCYAGYRLSADGCSCEDVDECASS
RGGCEHHCTNLAGSFQCSCEAGYRLHEDRRGCSPLEEPVVDLNGELPFVRPLPHIAVLQD
QLPRLFQDDDIGADEEEAELRGEHTLTEKFVCLDDSFGHDCSLTCDDCRNGGTCLPGLDG
CDCPEGWTGLICNETCPPDTFGKNCSFSCSCQNGGTCNSVTGTCRCPPGVSGTNCEDGCP
KGYYGKHCRKKCNCANQGRCHRLYGACLCDPGLYGRFCHLTCPPWAFGPGCSEECRCVQP
HTRSCDKRDGSCSCKAGFRGERCQAECEPGYFGLGCRQACTCPVGVACDPVSGECGKQCP
AGFQGEDCDQECPVGTFGVNCSGSCSCGGAPCHGVTGQCRCPPGRTGQDCEADCPEGRWG
LGCQEICPACQHGAHCDPETGACLCLPGFVGSRCQDVCPAGWFGPSCQTRCSCANDGHCH
PATGHCSCAPGWTGFSCQRACDSGHWGPDCSHLCNCSAGHGSCDAISGLCLCEAGYVGLQ
CDQRCPQGHFGPGCEQRCQCQHGAACDHVSGACTCPAGWRGTFCERACPAGFFGLDCRHA
CNCTAGAACDAVNGSCLCPAGRRGPRCAETCPAHTYGHNCSQACACFNGASCDPVHGQCH
CAPGWMGPSCLQACPAGLYGDNCRHSCLCQNGGTCDPVSGHCVCPEGWAGLACEKECLPG
HVGAGCPHSCSCLNGGLCDPHTGRCLCPAGWTGDKCQSPCLRGWFGEACAQRCSCPLGAA
CHHVTGACRCPPGFTGSGCEQACPPGSFGEDCAQTCWCPGENPACHPATGICSCAAGYHG
PSCRQRCPPGRYGPGCEQLCGCLNGGSCDAATGACHCPAGFLGADCSLTCPQGRFGPNCT
HVCGCGHGAACDPVTGTCLCPPGTAGVRCERGCPQNRFGVGCEHTCSCRNGGLCHATNGS
CSCGLGWTGPHCELACPPGRYGAACSLECSCRNNSTCEPTTGTCRCGPGFYGQACEHPCP
PGFHGAGCQGVCQCQHGAPCDPISGRCLCPAGFHGHFCESGCEPGSFGEGCHQRCDCDGG
APCDPVTGLCLCPPGRSGATCNLDCGRGQFGPSCTLHCDCGGGADCSPVSGQCHCVDGYM
GPTCREGGPLRLPENPSLAQGPVATLPASSRPTSGSSGLARH
Download sequence
Identical sequences ENSPANP00000002736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]