SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002775 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000002775
Domain Number - Region: 34-72,156-189,318-361
Classification Level Classification E-value
Superfamily TPR-like 0.00604
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002775   Gene: ENSPANG00000020167   Transcript: ENSPANT00000000309
Sequence length 724
Comment pep:known_by_projection chromosome:PapAnu2.0:11:6940354:6951956:1 gene:ENSPANG00000020167 transcript:ENSPANT00000000309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRLLRPLLLLLLLPPPGSPEPPGLAQLSPGAPPQAPDLLYADGLRAYAAGAWAPAVALL
REALRSQAALGRVRLDCGASCAAEPGAALPAVLLGAPEPDSGPGPTQGSWERQLLRAALR
RADCLTQCAARRLGPGGAARLRVGRTLRDAFRRREPYNYLQRAYYQLKKLDLAAAAAHTF
FVANPMHLQMREDMAKYRRMSGVQPQSFRDLETPPHWAAYDTGLELLERQEAGLALPRLE
EALQGSLAQMESCRADCQGPEEQEGAEEEEDGAGSQGGLYEAIARHWIQVLQCRQRCVGE
TATRPGRSFPVPDFLPSQLRRLHEAHAQVGNLSQAIENVLSVLLFYPDDEAAKRALNQYQ
AQLGEPRPGLGPREDIQRFTLRSLGEKRQLYYAMEHLGTSFKDPDPWTPAALIPEALREK
LREDQEKRPWDHEPPKKPLTYWKDVLLLEGVTLTQDSRQLNGSERAVLDGLLTPAECGVL
LQLAKDAAGAGARSGYRGRRSPHTPHERFEGLTVLKAAQLARAGTVGSQGAKLLLEVSER
VRTLTQAYFSPERPLHLSFTHLVCRSAIEGEQEQRMDLSHPVHADNCVLDPDTGECWREP
PAYTYRDYSSGLLYLNDDFQGGDLFFTEPNALTVTARVRPRCGRLVAFSSGGENPHGVWA
VTRGRRCALALWHTWAPEHREQEWIEAKELLEMPSKDPSPEPPSRRHQRVQDKAGKAPRV
REEL
Download sequence
Identical sequences ENSPANP00000002775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]