SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002779 from Papio anubis 76

(show help)
Strong hits

Sequence:	ENSPANP00000002779
Domain Number 1	Region: 137-179
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	2.85e-17
Family	LIM domain	0.0011
Further Details:

Domain Number 2	Region: 180-226
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	6.39e-16
Family	LIM domain	0.00024
Further Details:

Domain Number 3	Region: 72-118
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.0000000000000025
Family	LIM domain	0.00025
Further Details:

Domain Number 4	Region: 38-70
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.0000000000654
Family	LIM domain	0.0014
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

External link(s)	Protein: ENSPANP00000002779 Gene: ENSPANG00000024051 Transcript: ENSPANT00000013895
Sequence length	228
Comment	pep:known_by_projection chromosome:PapAnu2.0:1:162448277:162485420:1 gene:ENSPANG00000024051 transcript:ENSPANT00000013895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MTCELYLSLFFKEILSYTVCLCGLPATLLALLEIRMPNWGGGKKCGVCQKTVYFAEEVQC EGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKGYGYGQGAGTLSTDKG ESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKSCFR CAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE
Download sequence
Identical sequences	ENSPANP00000002779

SEARCH