SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002794 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002794
Domain Number 1 Region: 4-81
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.27e-16
Family THAP domain 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000002794
Domain Number - Region: 104-146
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00241
Family beta-sandwich domain of Sec23/24 0.036
Further Details:      
 
Domain Number - Region: 96-243
Classification Level Classification E-value
Superfamily Outer membrane efflux proteins (OEP) 0.00288
Family Outer membrane efflux proteins (OEP) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002794   Gene: ENSPANG00000011972   Transcript: ENSPANT00000011664
Sequence length 307
Comment pep:known_by_projection chromosome:PapAnu2.0:20:50069709:50070629:1 gene:ENSPANG00000011972 transcript:ENSPANT00000011664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGFTCCVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRL
CSVHFQGGRKTYTVRVPTIFPLRGVNERKVARRPAGAAAARRRQQQQQQQQQQQQQQQQQ
QQQQQPSPSASTAQTSQLQPNLVSASAAVLLTLQAAVDSSQAPGSVPPAPITPTGEDVKP
IDLTVQVEFAATEGAAAAAAASELQAATAGLEAAECPMGPQLVVVGEEGFPDTGSDHSYS
LSSGTTEEELLRKLNEQRDILALMEVKMKEMKGSIRHLRLTEAKLREELREKDRLLAMAV
IRKKHGM
Download sequence
Identical sequences A0A096MSM5
ENSPANP00000002794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]