SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002841 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002841
Domain Number 1 Region: 40-149
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000179
Family Link domain 0.013
Further Details:      
 
Domain Number 2 Region: 139-197
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000946
Family Complement control module/SCR domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002841   Gene: ENSPANG00000015211   Transcript: ENSPANT00000018873
Sequence length 629
Comment pep:known_by_projection chromosome:PapAnu2.0:2:173405741:173471496:-1 gene:ENSPANG00000015211 transcript:ENSPANT00000018873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAEGPSPPARWHSRLPGLWAAVLLLLGLPRLSVRADGKLFVLESQNGSQGLELEAARLS
CKSRGAHLVSADELRRVVQDCSFAVCATGWLADGTLGTTVCSKGSGEQQIMRAVDVRIES
NPVPGGTYSALCIKDEEKPCGDPPSFPHTILQGRTGLEMGDELLYVCAPGHITGHRETAF
TLLCNSCGEWYGLVQACGKDEAEAHIDYEDNFPDDRSVSFREPMEDSRTEAEEDRSQGDS
SEKAPKQDHLVSISVGRENIAQDKGFVPTTGLPGAGSSVSADSPGSRLLQKHLFWFPAEA
FHKPGLEKEVDDDTKKQFSAGDNHSSVKLVPGEPETKVIYDNTDGPLGPFVGKNDSKAGD
PVVSSSDESWLDGYPVTDGAWRKTEAEEEEDGDRGDGSVGLDENILLTPDQSILVEVKKP
WSSTLTPSEGMTHSSVLPSQMLDVEALALRPVSVSETEGNGDGDLTKYQSTLSWRFTTEE
SPMATLPYELTSSTLEILTATTVKQTPNHIPSTIMATTQPPGETTAPEIQDSFPYLLSED
FFGQEGPGPGTSEELHPTLESCVGGGCPGLSRGPVIATIVTVLCLLLLLAGVGMVWGYRK
YQHKSSVYKLNVGQRQARHYHQQIEMEKV
Download sequence
Identical sequences A0A096MSS1
ENSPANP00000002841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]