SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002893 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002893
Domain Number 1 Region: 481-820
Classification Level Classification E-value
Superfamily Folate-binding domain 1.02e-86
Family Aminomethyltransferase folate-binding domain 0.0000183
Further Details:      
 
Domain Number 2 Region: 67-288,388-473
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.91e-57
Family FAD-linked reductases, N-terminal domain 0.0000617
Further Details:      
 
Domain Number 3 Region: 288-387
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.77e-28
Family L-aminoacid/polyamine oxidase 0.0074
Further Details:      
 
Domain Number 4 Region: 822-916
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.0000000000000131
Family Aminomethyltransferase beta-barrel domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002893   Gene: ENSPANG00000026043   Transcript: ENSPANT00000028504
Sequence length 918
Comment pep:known_by_projection chromosome:PapAnu2.0:15:4480411:4556854:1 gene:ENSPANG00000026043 transcript:ENSPANT00000028504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLSRALRVAAARPRQSPTRGLGPCNLSSASGPTAEKSVPYQRTLKEGQSTSVVAQGPS
RPLPSTANVVVIGGGSLGCQTLYHLAKLGMSGAVLLERERLTSGTTWHTAGLLWQLRPSD
VEVELLAHTRRVVSRELEEETGLHTGWIQNGGLFIASNRQRLDEYKRLMSLGKAYGVESH
VLSPAETKTLYPLMNVDDLYGTLYVPHDGTMDPAGTCSTLARAASARGAQVIENCPVTGI
RVWTDDFGVRRVAGVETPHGSIQTPCVVNCAGVWASAVGRMAGVKVPLVAMHHAYVVTER
IEGIQNMPNVRDHDASVYLRLQGDALSVGGYEANPIFWEEVSDKFAFGLFDLDWEVFTQH
IEGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGEAPELRGFFLGCGFNSAGMMLGGGC
GQELAHWIIHGRPEKDMHGYDIRRFHHSLTDHPRWIRERSHESYAKNYSVVFPHDEPLAG
RNMRRDPLHEELLGQGCVFQERHGWERPGWFHPQGPAPVLEYDYYGAYGSRAHEDYAYRR
LLADEYTFDFPPHHDTIKKECLACRGAAAVFDMSYFGKFYLVGLDARKAADWLFSADVSR
PPGSTVYTCMLNHRGGTESDLTVSRLAPSHQASPLAPAFEGDGYYLAVGGAVAQHNWSHI
TTVLQDQKFQCQLIDSSEDLGMVSIQGPASRAILQEVLDADLSNEAFPFSTHKLLRAAGH
LVRAMRLSFVGELGWELHIPKASCIPVYRAVMAAGAKHGLINAGYRAIDSLSTEKGYRHW
HEDLRPDDSPLEAGLAFTCKLKSPVPFLGREALEQQRAAGLRRRLVCFTVEDKVPMFGLE
AIWRNGQVVGHVRRADFGFAIDKTIAYGYIHDPSGGPVSLDFVKSGDYGLERMGVTYGAR
AHLKSPFDPDNKRVKGTY
Download sequence
Identical sequences ENSPANP00000002893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]