SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002905 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002905
Domain Number 1 Region: 24-304
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.53e-57
Family FCH domain 0.0039
Further Details:      
 
Domain Number 2 Region: 568-651
Classification Level Classification E-value
Superfamily SH3-domain 7.74e-22
Family SH3-domain 0.00057
Further Details:      
 
Domain Number 3 Region: 471-542
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000102
Family SH3-domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002905   Gene: ENSPANG00000001966   Transcript: ENSPANT00000007135
Sequence length 740
Comment pep:known_by_projection chromosome:PapAnu2.0:14:62639484:62953804:-1 gene:ENSPANG00000001966 transcript:ENSPANT00000007135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPPPRKVKVTQELKNIQVEQMTKLQAKHQAECDLLEDMRTFSQKKAAIEREYAQGIQKL
ASQYLKRDWPGVKADDRNDYRSMYPVWKSFLEGTMQVAQSRMNICENYKNFISEPARTVR
SLKEQQLKRCVDQLTKIQTELQETVKDLAKGKKKYFETEQMAHAVREKADIEAKSKLSLF
QSRISLQKASVKLKARRSECNSKATHARNDYLLTLAAANAHQDRYYQTDLVNIMKALDGN
VYDHLKDYLIAFSRTELETCQAVQNTFQFLLENSSKVVRDYNLQLFLQENAVFHKPQPFQ
FQPCDSDTSRQLESETGTTEEHSLNKEARKWATRVAREHKNIVHQQRVLDDLECHGSAVS
EQSRAELEQKIDEARENIRKAEIIKLKAEARLDLLKQIGVSVDTWLKSAMSQVMEELENE
RWARPPAVTSNGTLHSLNADTEREEGEEFEDNMDVFDDSSSSPSGTLRNYPLTCKVVYSY
KASQPDELTIEEHEVLEVIEDGDMEDWVKARNKVGQVGYVPEKYLQFPTSNSLLSMLQSL
ATLDSRSHTSSNSTEAELVSGSLNGDASVCFVKALYDYEGQTDDELSFPEGAIIRILNKE
NQDDDGFWEGEFNGRIGVFPSVLVEELSASENGDTPWMREIQISPSPKPHASLPPLPLYD
QPPSSPYPSPDKRSSLYFPRSPSANENSLHAESPGFSQASRHTPETSHGKLRPVRAAPPP
PMQNHRRPAEKIEDVEITLV
Download sequence
Identical sequences A0A096MSY1
ENSPANP00000002905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]