SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002911 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002911
Domain Number 1 Region: 5-95
Classification Level Classification E-value
Superfamily SET domain 2.35e-23
Family Histone lysine methyltransferases 0.044
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000002911
Domain Number - Region: 128-225
Classification Level Classification E-value
Superfamily TPR-like 0.0338
Family Tetratricopeptide repeat (TPR) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002911   Gene: ENSPANG00000005527   Transcript: ENSPANT00000012262
Sequence length 254
Comment pep:known_by_projection chromosome:PapAnu2.0:1:203192048:203373205:1 gene:ENSPANG00000005527 transcript:ENSPANT00000012262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLQVICNSFTICNAEMQEVGVGLYPSISLLNHSCDPNCSIVFNGPHLLLRAVRDIEVGEE
LTICYLDMLMTSEERRKQLRDQYCFECDCFRCQTQDKDADMLTGDEQVWKEVQESLKKIE
ELKAHWKWEQVLAMCQAIISSNSERLPDINVYQLKVLDCAMDACINLGLLEEALFYGTRT
MEPYRIFFPGSHPVRGVQVMKVGKLQLHQGMFPQAMKNLRLAFDIMRVTHGREHSLIEDL
ILLLEECDANIRAS
Download sequence
Identical sequences ENSPANP00000002911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]