SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002961 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002961
Domain Number 1 Region: 263-434
Classification Level Classification E-value
Superfamily Fic-like 1.31e-50
Family Fic-like 0.0027
Further Details:      
 
Domain Number 2 Region: 109-181
Classification Level Classification E-value
Superfamily TPR-like 0.00000000481
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002961   Gene: ENSPANG00000025435   Transcript: ENSPANT00000006174
Sequence length 463
Comment pep:known_by_projection chromosome:PapAnu2.0:11:107636244:107640680:1 gene:ENSPANG00000025435 transcript:ENSPANT00000006174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLMPMASVMAVTEPKWVSVWGRFLWVTLLSMVLGSLLALLLPLGAVEEQCLAVLKGFYL
LRSKLDRAQHAAAPAAKCSSPSTELSITSRGVTLLVAKTKASPAGKLEARAALNQALEMK
RQGKREKAQKLFMHALKMDPDFVDALTEFGIFSEEDKDIIQADYLYTRALTISPYHEKAL
VSRDRTLPLVEEIDQRYFSIIDSKVKKIMSIPKGNSALRRVMEETYYHHIYHTVAIEGNT
LTLSEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVSRIGSVTISDVLEIHRRV
LGYVDPVEAGRFRTTQVLVGHHIPPHPQDVEKQMQEFVQWLNSEDAMNLHPVEFAALAHY
KLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSEYYHVLEAANEGDVRPFIRF
IAKCTETTLDTLLFATTEYSVALPEAQPNHSGFKETLPVKPSP
Download sequence
Identical sequences A0A096MT37
ENSPANP00000002961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]