SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002973 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002973
Domain Number 1 Region: 1-245
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.08e-64
Family BAR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 356-471
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 6.28e-42
Family Pyk2-associated protein beta ARF-GAP domain 0.00016
Further Details:      
 
Domain Number 3 Region: 216-321
Classification Level Classification E-value
Superfamily PH domain-like 3.34e-28
Family Pleckstrin-homology domain (PH domain) 0.0036
Further Details:      
 
Domain Number 4 Region: 566-684
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.93e-25
Family Ankyrin repeat 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002973   Gene: ENSPANG00000017081   Transcript: ENSPANT00000005431
Sequence length 734
Comment pep:known_by_projection chromosome:PapAnu2.0:2:185214924:185328082:-1 gene:ENSPANG00000017081 transcript:ENSPANT00000005431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIDTGKAFCVANKQFMNGIRDLAQYSSNDAVVETSLTKFSDSLQEMINFHTILFDQTQRS
IKAQLQNFVKEDLRKFKDAKKQFEKVSEEKENALVKNAQVQRNKQHEVEEATNILTATRK
CFRHIALDYVLQINVLQSKRRSEILKSMLSFMYAHLAFFHQGYDLFSELGPYMKDLGAQL
DRLVVDAAKEKREMEQKHSTIQQKDFSSDDSKLEYNVDAANGIVMEGYLFKRASNAFKTW
NRRWFSIQNNQLVYQKKFKDNPTVVVEDLRLCTVKHCEDIERRFCFEVVSPTKSCMLQAD
SEKLRQAWIKAVQTSIATAYREKGDESEKLDKKSSPSTGSLDSGSESKEKLLKGESALQR
VQCIPGNASCCDCGLADPRWASINLGITLCIECSGIHRSLGVHFSKVRSLTLDTWEPELL
KLMCELGNDVINRVYEANVEKMGIKKPQPGQRQEKEAYIKAKYVERKFVDKYSISLSPPE
QQKKFVSKSSEEKRLSISKFGPGDQVRASAQSSVKSNDSGIQQSSDDGRESLPSTVSANS
LYEPEGERQDSSVFLDSKHLNPGLQLYRASYEKNLPKMAEALAHGADVNWANSEENKATP
LIQAVLGGSLVTCEFLLQNGANVNQRDVQGRGPLHHATVLGHTGQVCLFLKRGANQHATD
EEGKDPLSIAVEAANADIVTLLRLARMNEEMRESEGLYGQPGDETYQDIFRDFSQMASNN
PEKLNRFQQDSQKF
Download sequence
Identical sequences ENSPANP00000002973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]