SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002981 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002981
Domain Number 1 Region: 684-711
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000222
Family CCCH zinc finger 0.0033
Further Details:      
 
Domain Number 2 Region: 791-813
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000693
Family CCCH zinc finger 0.0058
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000002981
Domain Number - Region: 757-790
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000497
Family CCCH zinc finger 0.0044
Further Details:      
 
Domain Number - Region: 739-761
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0103
Family CCCH zinc finger 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002981   Gene: ENSPANG00000016578   Transcript: ENSPANT00000021978
Sequence length 965
Comment pep:known_by_projection chromosome:PapAnu2.0:8:138290564:138396602:-1 gene:ENSPANG00000016578 transcript:ENSPANT00000021978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSRGLGRASRTWEMEEKEILRRQIRLLQGLIDDYKTLHGNAPGPGTPTASGWQPPTYHS
GRAFSARYPRPSRRGYSSHHGPLWRKKYSLVNRPPGPSDPPADPAVRPLHGARGGPAPVP
QQHILGRQVQLNQGQNVVIKVKPPSKSGSASASGAQRGSLEEYEDTLWSDQRPREGEGEP
PRGQLQPSRPARMRGTCNVEDPLLVCQKEAGKPRVVKSVGSVGDSPREPRRTVSESVIAI
KASFPSSALPPRTGVVPGRKLGSHSVASCAPQLLGDRRVDAGHTDQPVPSGSVVGPARLA
SGPRQAREASLVVTCRTNKFRKNNYKWVAASAKSPRAARRALSPRVAAENVCKVPAGTAN
KVEKPQLIDDPEPKPRKPATSSKPGSAPSKYKWKASSPSASSSSSFRWQSEAGSKDHASQ
LSPVPSRSPPGDRPAVGLSGLKPVSGETPLSAYKVKSRTKIIRRRGSTSLPGDKKGSPAP
ATTAKSHLSLRRRQALRGKSSPILKKTPNKGLVQVTTHRLCRLPPSRAHLTTKEASSLRA
VQTPPTSKVIKTRYRIVKKTPASPLSAPPFPLSLPSWRARRLSLSRSLVLNRLRPVASGG
GKAQPGSPRWRSKGYRCIGGVLYKVSANKLSKTSGQPGDAGSKPLLRTAGRLDPAGSCSR
SLASRAVQRSLAIIRQARQRREKRKEYCMYYNRFGRCNRGERCPYIHDPEKVAVCTRFVR
GTCKKTDGTCPFSHHVSKEKMPVCSYFLKGICSNSNCPYSHVYVSRKAEVCSDFLKGYCP
LGAKCKKKHTLLCPDFARRGACPRGAQCQLLHRTQKRHSRRAATSPAPGPSDAAARSRAS
ASHGPRKPSAAQRPIRQTPSSPALTAAALAAPSRSPGGSASPSSLKASSSSCSSSSSSPP
ASLDHEAPSLQEAALAAARSNRLCKLPSFISLQSSPSPGAQPRVRAPRAPLTKDSGKPLH
IKPRL
Download sequence
Identical sequences ENSPANP00000002981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]