SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002983 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002983
Domain Number 1 Region: 404-626
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-55
Family DBL homology domain (DH-domain) 0.00016
Further Details:      
 
Domain Number 2 Region: 190-323
Classification Level Classification E-value
Superfamily BRCT domain 2.04e-23
Family DNA topoisomerase II binding protein 1, TopBP1 0.055
Further Details:      
 
Domain Number 3 Region: 107-219
Classification Level Classification E-value
Superfamily BRCT domain 1.19e-18
Family DNA ligase 0.028
Further Details:      
 
Domain Number 4 Region: 617-762
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000144
Family Pleckstrin-homology domain (PH domain) 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002983   Gene: ENSPANG00000018155   Transcript: ENSPANT00000009914
Sequence length 886
Comment pep:known_by_projection chromosome:PapAnu2.0:2:112898233:112969260:-1 gene:ENSPANG00000018155 transcript:ENSPANT00000009914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAENSVLTSTTGRTSLADSSIFDSKVTEISKENLLIESTSYVEEEMPQIETRVILVQEAG
KQEELIKALKDIKVGFVKMESVEEFEGLDSPEFENVFVVMDFQDSVFNDLYKADCRVIGP
PIVLNCSQKGEPLPFSCRPLYCTSMMNLVLCFTGFRKKEELVRLVTLVHHMGGVIRKDFN
SKVTHLVANCTQGEKFRVAVSLGTPIMKPEWIYKAWERRNEQDFCAAVDDFRNEFKVPPF
QDCILSFLGFSDEEKTNMEEMTEMQGGKYLPLGDERCTHLVVEENIVKDLPFEPSKKLYV
VKQEWFWGSIQMDARAGETMYLYEKANTPELKKSVSMLSLNTPNSNRKRRRLKETLAQLS
RETDVSPFPPRKRPSAEHSLSIGSLLDISNTPESSINYGDTPKSCTKSSKNSTPVPSKQS
ARWQVAKELYQTESNYVNILATIIQLFQVPLEEEGQCGGRILAPEEIKTIFGSIPDIFDV
HTKIKDDLEDLIVNWDESKSIGDIFLKYSKDLVKTYPPFVNFFEMSKETIIKCEKQKPRF
HAFLKINQAKPECGRQSLVELLIRPVQRLPSVALLLNDLKKHTADENPDKSTLEKAIGSL
KEVMMHINEDKRKTEAQKQIFDVVYEVDGCPANLLSSHRSLIQRVETISLGEHPCDRGEQ
VTLFLFNDCLEIARKRHKVIGTFRSPHGQTRPPASLKHIHLMPLSQIKKVLDIRETEDCH
NAFALLVRPPTEQANVLLSFQMTSDELPKENWLKMLCRHVANTICKADAENLIYTADPES
FEVNTKDMDSTLSRASRAIKKTSKKVTRAFSFSKTPKRALRRALMTSHGSHGSVEGRSPS
SNDKHVMSRLSSTSSLAGIPSPSLVSLPSFFERRSHTLSRSTTHLI
Download sequence
Identical sequences A0A096MT59
ENSPANP00000002983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]