SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003025 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003025
Domain Number 1 Region: 16-230
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.15e-50
Family BAR domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003025   Gene: ENSPANG00000020851   Transcript: ENSPANT00000028264
Sequence length 254
Comment pep:known_by_projection chromosome:PapAnu2.0:8:20570038:20594141:-1 gene:ENSPANG00000020851 transcript:ENSPANT00000028264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSWRIPFKIGQPKKQIVPKTVERDFEREYGKLQQLEEQTRKLQKDMKKSTDADLAMSKSA
VKISLDLLSNPLCEQDQDLLSMVTALDTAMKRMDAFNQEKVNQIQKTVIEPLKKFGSVFP
SLNMAVKRREQALQDYRRLQAKVEKYEEKEKTGPVLAKLHQAREELRPVREDFEAKNRQL
LEEMPRFYGSRLDYFQPSFESLIRAQVVYYSEMHKIFGDLTQQLDQPGHSDEQRERENEA
KLSELRALSIVADD
Download sequence
Identical sequences A0A0D9RUT6
ENSPANP00000003025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]