SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003029 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003029
Domain Number 1 Region: 137-225
Classification Level Classification E-value
Superfamily eEF-1beta-like 2.62e-36
Family eEF-1beta-like 0.000003
Further Details:      
 
Domain Number 2 Region: 8-63
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00000000000625
Family Glutathione S-transferase (GST), C-terminal domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003029   Gene: ENSPANG00000011248   Transcript: ENSPANT00000018308
Sequence length 225
Comment pep:known_by_projection chromosome:PapAnu2.0:12:68127971:68132914:1 gene:ENSPANG00000011248 transcript:ENSPANT00000018308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSGPPPADLCHALRWYNHIK
SYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLRE
ERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPV
GYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKI
Download sequence
Identical sequences A0A096MTA1 A0A2K5HRX8 A0A2K5MUP4 A0A2K5Z9X3 A0A2K6BJ79 A0A2K6MA63 A0A2K6R7G6 H2P8E2 I0FGN5 I7GHJ0
ENSPPYP00000014648 ENSMMUP00000001412 9544.ENSMMUP00000001413 9600.ENSPPYP00000014648 NP_001253314.1.72884 NP_001271633.1.63531 XP_002812836.1.23681 XP_002812837.1.23681 XP_007964160.1.81039 XP_007964161.1.81039 XP_010350949.1.97406 XP_010350950.1.97406 XP_011716257.1.29376 XP_011805272.1.43180 XP_011805273.1.43180 XP_011849261.1.47321 XP_011849262.1.47321 XP_011903031.1.92194 XP_014966211.1.72884 XP_017749399.1.44346 XP_017749400.1.44346 ENSPANP00000003029 ENSMMUP00000001412 ENSMMUP00000001413 ENSPPYP00000014648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]