SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003044 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003044
Domain Number 1 Region: 534-561,604-687
Classification Level Classification E-value
Superfamily SpoIIaa-like 8.24e-16
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003044   Gene: ENSPANG00000016992   Transcript: ENSPANT00000024961
Sequence length 701
Comment pep:known_by_projection chromosome:PapAnu2.0:1:3081154:3084344:1 gene:ENSPANG00000016992 transcript:ENSPANT00000024961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDESPEPLQQDRGPVLVRRQRPAPQGLCEMLKARLWRSCSCSVLCARALVQDLLPATRWL
RQYRPREYLAGDVMSGLVIGIILVPQAIAYSLLAGLQPIYSLYTSFFANLIYFLMGTSRH
VSVGIFSLLCLMVGQVVDRELQLAGFDPSQEGLQPGANSSILNSSDAMLDCGRDCYAIRI
ATALTLMTGLYQVLMGVLRLGFVSAYLSQPLLDGFAMGASVTILTSQLKHLLGVRIPRHQ
GPGMVVLTWLSLLRSAGQANVCDVVTSTVCLAVLLAAKELSDRYRRRLRVPLPTELLVIV
VATLVSHFGQLHRRFGSSVAGDIPTGFMPPQVPEPRLMQRVALDAVALALVGAAFSISLA
EMFARNHGYSVRANQELLAVGCCNVLPAFLHCFATSAALAKSLVKTATGCRTQLSSVVSA
TVVLLVLLALAPLFHDLQRSVLACVIVVSLRGALRKVWDLPRLWRMSPADALVWAGTAAT
CMLVSTEAGLLVGVILSLLSLAGRTQRPRATLLARIGNSAFYEDATEFEGLVPEPGVRVF
RFGGPLYYANKDFFLRSLYSLTGLDAGCVAARRKERGSEWEVGDGGPAQGKDLGAVSSRA
ALAPAAAGFHTVVIDCAPLLFLDAAGVTTLQDLRRDYGALGISLLLACCSPPVRDVLSRG
GFLGEGPGDVAEEEQLFLSVHDAVQTARARHRELEATDAHP
Download sequence
Identical sequences A0A096MTB5
ENSPANP00000003044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]