SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003050 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003050
Domain Number 1 Region: 502-532
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000246
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003050   Gene: ENSPANG00000007696   Transcript: ENSPANT00000018668
Sequence length 536
Comment pep:known_by_projection chromosome:PapAnu2.0:2:38657296:38662596:1 gene:ENSPANG00000007696 transcript:ENSPANT00000018668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEPPQEALAEPLEHESPAAPSSAGHTNGQEDDDQKNQAERKADNHTAHRIADQTALRVP
SQAKFNIFSQTTNGVAEQNGRSTPGQAGHRASDPANVSDLRADDQVDQTPSEQTEGKASS
QANNVQYEQSDGQVSGLTEERTAEQIERRLSSQAERVTSGQIDGRLSMPSDQRGSRQTDH
RMSDQSERRASEQMDRRLSDKAEGITSEQITYTLSRLSEKRPSVQIIDSGSSVPSDRSPS
VQIDSGSSVPSDQRPSVQIDRRMSGKVRRTSVKTDYRLASLVHQGTSEQIDLRSHGLVDH
KTSVKTHHQVYGKATELAEHQTIDQAHSNADQPPVDKADYSESDQIDHLADRQANHKDQL
SYYERHGQSEDRIFPQLGNSKKDKEADYRVQPCKFEDSQVDLNSKLSVEMETQNATTTPA
YHPVDARFTSNFQAKDQALFPRLPSISSKLNHISSQEKTQAVVTKSDEFSEIEQGKSYRI
RNQTCRRFPSIVYEDPYQVALQYMEKHHILQIFQQITENLVYEKPEDPLNFMLCQV
Download sequence
Identical sequences ENSPANP00000003050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]